Classified by application

Building Blocks and Intermediates

Thin Layer Chromatography

Screening Libraries

Bioactive Small Molecules

Dye and Bio-assay Reagents

Natural Products

Isotope Compounds

Peptides

CS-6416
γ-Glu-Phe
  • Cat. No.: 

    CS-6416
  • CAS No.: 

    7432-24-8
CS-8059
N-terminally acetylated Endomorphin-1
  • Cat. No.: 

    CS-8059
  • CAS No.: 

CS-6344
Microtubule-associated protein tau (26-44)
  • Cat. No.: 

    CS-6344
  • CAS No.: 

CS-6345
NH2-KLGADTDGEQDQHMTYGGQ-COOH
  • Cat. No.: 

    CS-6345
  • CAS No.: 

CS-0031499
L-JNKI-1
  • Cat. No.: 

    CS-0031499
  • CAS No.: 

CS-0064705
Cyclo(Phe-Pro)
  • Cat. No.: 

    CS-0064705
  • CAS No.: 

    14705-60-3
CS-8040
HAE
  • Cat. No.: 

    CS-8040
  • CAS No.: 

    64111-99-5
CS-7598
[bAla8]-Neurokinin A(4-10)
  • Cat. No.: 

    CS-7598
  • CAS No.: 

    122063-01-8
CS-0044838
Angiotensin III, human, mouse
  • Cat. No.: 

    CS-0044838
  • CAS No.: 

    13602-53-4
CS-7061
c-Myc Peptide Trifluoroacetate
  • Cat. No.: 

    CS-7061
  • CAS No.: 

    145646-22-6
CS-7074
V5 Epitope Tag Peptide Trifluoroacetate
  • Cat. No.: 

    CS-7074
  • CAS No.: 

CS-0100335
Apelin-13 TFA
  • Cat. No.: 

    CS-0100335
  • CAS No.: 

CS-5938
Aviptadil
  • Cat. No.: 

    CS-5938
  • CAS No.: 

    40077-57-4
CS-8039
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8039
  • CAS No.: 

CS-8051
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8051
  • CAS No.: 

CS-5673
Protirelin Acetate
  • Cat. No.: 

    CS-5673
  • CAS No.: 

    120876-23-5
CS-0058948
TFLLR-NH2(TFA)
  • Cat. No.: 

    CS-0058948
  • CAS No.: 

    1313730-19-6
CS-7043
Hexa-His
  • Cat. No.: 

    CS-7043
  • CAS No.: 

    64134-30-1
CS-0043429
RNAIII-inhibiting peptide(TFA)
  • Cat. No.: 

    CS-0043429
  • CAS No.: 

CS-0046346
[Sar1, Ile8]-Angiotensin II TFA
  • Cat. No.: 

    CS-0046346
  • CAS No.: